General Information

  • ID:  hor006650
  • Uniprot ID:  P83056
  • Protein name:  Kininogen-1
  • Gene name:  NA
  • Organism:  Bombina variegata (Yellow-bellied toad)
  • Family:  Bradykinin-related peptide family
  • Source:  Animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0045986 negative regulation of smooth muscle contraction; GO:0045987 positive regulation of smooth muscle contraction; GO:0050796 regulation of insulin secretion; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VERNVPESEEKTEQFLRDLFEISRLQRRPAGFTPFRGKFHSQSLRGLSETKRIYNAIWPCKHCNKCKPGLLCKK
  • Length:  74(24-97)
  • Propeptide:  MRLWFCLSFLIILCVEHFPGTLAVERNVPESEEKTEQFLRDLFEISRLQRRPAGFTPFRGKFHSQSLRGLSETKRIYNAIWPCKHCNKCKPGLLCKK
  • Signal peptide:  MRLWFCLSFLIILCVEHFPGTLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Ala3,Thr6]bradykinin: produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle. Possesses insulin-releasing activity. May target bradykinin receptors (BDKRB).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83056-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006650_AF2.pdbhor006650_ESM.pdb

Physical Information

Mass: 1003736 Formula: C387H619N117O106S4
Absent amino acids: M Common amino acids: KREL
pI: 10.41 Basic residues: 18
Polar residues: 20 Hydrophobic residues: 20
Hydrophobicity: -87.03 Boman Index: -20385
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 63.24
Instability Index: 7391.49 Extinction Coefficient cystines: 7240
Absorbance 280nm: 99.18

Literature

  • PubMed ID:  12230583
  • Title:  Novel bradykinins and their precursor cDNAs from European yellow-bellied toad (Bombina variegata) skin.
  • PubMed ID:  15134346
  • Title:  Skin secretion of the toad Bombina variegata contains multiple insulin-releasing peptides including bombesin and entirely novel insulinotropic structu